Gene number
CASP3 Protein origin
E.coli Use before
1 year Protein number
P42574 Protein purity
≥ 90% Information about sequence
Partial Expected molecular weight
20.7kDa Protein region
29-175aa Shipping requirements
Blue ice Group
recombinants Estimated production time
7-11 business days Verified reactivity
Homo sapiens (Human) Source
Recombinants or rec. proteins Notes
For research use only. Not for diagnostic procedures. Storage recommendation
Aliquot and store at -20°C. Minimize freezing and thawing. Other name
Apopain; Cysteine protease CPP32 ; CPP-32; Protein Yama; SREBP cleavage activity 1 ; SCA-1 Protein sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD Description
Human and some mouse caspases are active in apoptosis and cell death and even in necrosis and inflammation. CASP Gene and orthologous enzymes have been identifies successfully in the signal transduction cascade and pathways. Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.