• 024140089086
  • de@gentaur.com
Recombinant Human Caspase-3(CASP3),partial

Size

Recombinant Human Caspase-3(CASP3),partial

1 mg

Catalog no.

RPC20183

Price

1157 EUR

Buy Recombinant Human Caspase-3(CASP3),partial at gentaur.com

Gene number

CASP3

Protein origin

E.coli

Use before

1 year

Protein number

P42574

Protein purity

≥ 90%

Information about sequence

Partial

Expected molecular weight

20.7kDa

Protein region

29-175aa

Shipping requirements

Blue ice

Group

recombinants

Estimated production time

7-11 business days

Verified reactivity

Homo sapiens (Human)

Source

Recombinants or rec. proteins

Notes

For research use only. Not for diagnostic procedures.

Storage recommendation

Aliquot and store at -20°C. Minimize freezing and thawing.

Other name

Apopain; Cysteine protease CPP32 ; CPP-32; Protein Yama; SREBP cleavage activity 1 ; SCA-1

Protein sequence

SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD

Description

Human and some mouse caspases are active in apoptosis and cell death and even in necrosis and inflammation. CASP Gene and orthologous enzymes have been identifies successfully in the signal transduction cascade and pathways.

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.